Anti IL2RB pAb (ATL-HPA062657 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA062657-25

• 

Product Description

Protein Description: interleukin 2 receptor, beta
Gene Name: IL2RB
Alternative Gene Name: CD122, IL15RB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068227: 53%, ENSRNOG00000048636: 60%
Entrez Gene ID: 3560
Uniprot ID: P14784
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DRRRWNQTCELLPVSQASWACNLILGAPDSQKLTTVDIVTLRVLCREGVRWRVMAIQ
• Gene Sequence: DRRRWNQTCELLPVSQASWACNLILGAPDSQKLTTVDIVTLRVLCREGVRWRVMAIQ
• Gene ID - Mouse: ENSMUSG00000068227
• Gene ID - Rat: ENSRNOG00000048636
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.