Protein Description: interleukin 27 receptor subunit alpha
Gene Name: IL27RA
Alternative Gene Name: CRL1, IL-27R, TCCR, WSX-1, WSX1, zcytor1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005465: 65%, ENSRNOG00000005747: 65%
Entrez Gene ID: 9466
Uniprot ID: Q6UWB1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: IL27RA
Alternative Gene Name: CRL1, IL-27R, TCCR, WSX-1, WSX1, zcytor1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005465: 65%, ENSRNOG00000005747: 65%
Entrez Gene ID: 9466
Uniprot ID: Q6UWB1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | QCYGVGPLGDLNCSWEPLGDLGAPSELHLQSQKYRSNKTQTVAVAAGRSWVAIPREQLTMSDKLLVWGTKAGQPLWPPVFVNL |
Documents & Links for Anti IL27RA pAb (ATL-HPA073441) | |
Datasheet | Anti IL27RA pAb (ATL-HPA073441) Datasheet (External Link) |
Vendor Page | Anti IL27RA pAb (ATL-HPA073441) at Atlas |
Documents & Links for Anti IL27RA pAb (ATL-HPA073441) | |
Datasheet | Anti IL27RA pAb (ATL-HPA073441) Datasheet (External Link) |
Vendor Page | Anti IL27RA pAb (ATL-HPA073441) |