Anti IL1RAPL2 pAb (ATL-HPA036129 w/enhanced validation)

Catalog No:
ATL-HPA036129-25
$401.00

On sale now! 25% off. Add item to cart to see discounted price. Valid thru Mar 2025.

Protein Description: interleukin 1 receptor accessory protein-like 2
Gene Name: IL1RAPL2
Alternative Gene Name: IL-1R9, IL1R9, IL1RAPL-2, TIGIRR-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059203: 100%, ENSRNOG00000062221: 100%
Entrez Gene ID: 26280
Uniprot ID: Q9NP60
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence SMSLTVAENESGLCYNSRIRYLEKSEVTKRKEISCPDMDDFKKSDQEPDVVWYKECKPKMWRSIIIQKGNALLIQEVQEEDGGNYTCELKYEG

Documents & Links for Anti IL1RAPL2 pAb (ATL-HPA036129 w/enhanced validation)
Datasheet Anti IL1RAPL2 pAb (ATL-HPA036129 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti IL1RAPL2 pAb (ATL-HPA036129 w/enhanced validation) at Atlas

Documents & Links for Anti IL1RAPL2 pAb (ATL-HPA036129 w/enhanced validation)
Datasheet Anti IL1RAPL2 pAb (ATL-HPA036129 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti IL1RAPL2 pAb (ATL-HPA036129 w/enhanced validation)