Protein Description: interleukin 12 receptor, beta 1
Gene Name: IL12RB1
Alternative Gene Name: CD212, IL12RB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000111872: 45%, ENSRNOG00000019216: 46%
Entrez Gene ID: 3594
Uniprot ID: P42701
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: IL12RB1
Alternative Gene Name: CD212, IL12RB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000111872: 45%, ENSRNOG00000019216: 46%
Entrez Gene ID: 3594
Uniprot ID: P42701
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | TSECCFQDPPYPDADSGSASGPRDLRCYRISSDRYECSWQYEGPTAGVSHFLRCCLSSGRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVES |
| Documents & Links for Anti IL12RB1 pAb (ATL-HPA074414) | |
| Datasheet | Anti IL12RB1 pAb (ATL-HPA074414) Datasheet (External Link) |
| Vendor Page | Anti IL12RB1 pAb (ATL-HPA074414) at Atlas |
| Documents & Links for Anti IL12RB1 pAb (ATL-HPA074414) | |
| Datasheet | Anti IL12RB1 pAb (ATL-HPA074414) Datasheet (External Link) |
| Vendor Page | Anti IL12RB1 pAb (ATL-HPA074414) |