Protein Description: interleukin 10
Gene Name: IL10
Alternative Gene Name: CSIF, IL-10, IL10A, TGIF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016529: 78%, ENSRNOG00000004647: 80%
Entrez Gene ID: 3586
Uniprot ID: P22301
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: IL10
Alternative Gene Name: CSIF, IL-10, IL10A, TGIF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016529: 78%, ENSRNOG00000004647: 80%
Entrez Gene ID: 3586
Uniprot ID: P22301
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | ENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN |
Documents & Links for Anti IL10 pAb (ATL-HPA071391) | |
Datasheet | Anti IL10 pAb (ATL-HPA071391) Datasheet (External Link) |
Vendor Page | Anti IL10 pAb (ATL-HPA071391) at Atlas |
Documents & Links for Anti IL10 pAb (ATL-HPA071391) | |
Datasheet | Anti IL10 pAb (ATL-HPA071391) Datasheet (External Link) |
Vendor Page | Anti IL10 pAb (ATL-HPA071391) |