![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/101090/181136/atl-hpa073266_anti-ikzf3-pab-atl-hpa073266-wenhanced-validation_62804__00937.1681137393.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG")
Protein Description: IKAROS family zinc finger 3
Gene Name: IKZF3
Alternative Gene Name: Aiolos, ZNFN1A3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018168: 83%, ENSRNOG00000007200: 85%
Entrez Gene ID: 22806
Uniprot ID: Q9UKT9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: IKZF3
Alternative Gene Name: Aiolos, ZNFN1A3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018168: 83%, ENSRNOG00000007200: 85%
Entrez Gene ID: 22806
Uniprot ID: Q9UKT9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | TPPAPTSEMVPVISSMYPIALTRAEMSNGAPQELEKKSIHLPEKSVPSERGLSPNNSGHD |
| Documents & Links for Anti IKZF3 pAb (ATL-HPA073266 w/enhanced validation) | |
| Datasheet | Anti IKZF3 pAb (ATL-HPA073266 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti IKZF3 pAb (ATL-HPA073266 w/enhanced validation) at Atlas |
| Documents & Links for Anti IKZF3 pAb (ATL-HPA073266 w/enhanced validation) | |
| Datasheet | Anti IKZF3 pAb (ATL-HPA073266 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti IKZF3 pAb (ATL-HPA073266 w/enhanced validation) |