Protein Description: immunoglobulin superfamily member 8
Gene Name: IGSF8
Alternative Gene Name: CD316, CD81P3, EWI2, PGRL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038034: 96%, ENSRNOG00000007604: 96%
Entrez Gene ID: 93185
Uniprot ID: Q969P0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: IGSF8
Alternative Gene Name: CD316, CD81P3, EWI2, PGRL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038034: 96%, ENSRNOG00000007604: 96%
Entrez Gene ID: 93185
Uniprot ID: Q969P0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | RLVAQLDTEGVGSLGPGYEGRHIAMEKVASRTYRLRLEAARPGDAGTYRCLAKAYVRGSGTRLREAASARSRPLPVHVRE |
Documents & Links for Anti IGSF8 pAb (ATL-HPA075970) | |
Datasheet | Anti IGSF8 pAb (ATL-HPA075970) Datasheet (External Link) |
Vendor Page | Anti IGSF8 pAb (ATL-HPA075970) at Atlas |
Documents & Links for Anti IGSF8 pAb (ATL-HPA075970) | |
Datasheet | Anti IGSF8 pAb (ATL-HPA075970) Datasheet (External Link) |
Vendor Page | Anti IGSF8 pAb (ATL-HPA075970) |