Anti IGHMBP2 pAb (ATL-HPA060994)

Catalog No:
ATL-HPA060994-25
$303.00

Description

Product Description

Protein Description: immunoglobulin mu binding protein 2
Gene Name: IGHMBP2
Alternative Gene Name: CATF1, CMT2S, HCSA, HMN6, SMARD1, SMUBP2, ZFAND7
Isotype: IgG
Interspecies mouse/rat: ,
Entrez Gene ID: 3508
Uniprot ID: P38935
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NRKGEVGFLAEDRRINVAVTRARRHVAVICDSRTVNNHAFLKTLVEYFTQHGEVRTAFEYLDDIVPENYSHENSQG
Gene Sequence NRKGEVGFLAEDRRINVAVTRARRHVAVICDSRTVNNHAFLKTLVEYFTQHGEVRTAFEYLDDIVPENYSHENSQG
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti IGHMBP2 pAb (ATL-HPA060994)
Datasheet Anti IGHMBP2 pAb (ATL-HPA060994) Datasheet (External Link)
Vendor Page Anti IGHMBP2 pAb (ATL-HPA060994) at Atlas Antibodies

Documents & Links for Anti IGHMBP2 pAb (ATL-HPA060994)
Datasheet Anti IGHMBP2 pAb (ATL-HPA060994) Datasheet (External Link)
Vendor Page Anti IGHMBP2 pAb (ATL-HPA060994)

Product Description

Protein Description: immunoglobulin mu binding protein 2
Gene Name: IGHMBP2
Alternative Gene Name: CATF1, CMT2S, HCSA, HMN6, SMARD1, SMUBP2, ZFAND7
Isotype: IgG
Interspecies mouse/rat: ,
Entrez Gene ID: 3508
Uniprot ID: P38935
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NRKGEVGFLAEDRRINVAVTRARRHVAVICDSRTVNNHAFLKTLVEYFTQHGEVRTAFEYLDDIVPENYSHENSQG
Gene Sequence NRKGEVGFLAEDRRINVAVTRARRHVAVICDSRTVNNHAFLKTLVEYFTQHGEVRTAFEYLDDIVPENYSHENSQG
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti IGHMBP2 pAb (ATL-HPA060994)
Datasheet Anti IGHMBP2 pAb (ATL-HPA060994) Datasheet (External Link)
Vendor Page Anti IGHMBP2 pAb (ATL-HPA060994) at Atlas Antibodies

Documents & Links for Anti IGHMBP2 pAb (ATL-HPA060994)
Datasheet Anti IGHMBP2 pAb (ATL-HPA060994) Datasheet (External Link)
Vendor Page Anti IGHMBP2 pAb (ATL-HPA060994)