Description
Product Description
Protein Description: immunoglobulin mu binding protein 2
Gene Name: IGHMBP2
Alternative Gene Name: CATF1, CMT2S, HCSA, HMN6, SMARD1, SMUBP2, ZFAND7
Isotype: IgG
Interspecies mouse/rat: ,
Entrez Gene ID: 3508
Uniprot ID: P38935
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: IGHMBP2
Alternative Gene Name: CATF1, CMT2S, HCSA, HMN6, SMARD1, SMUBP2, ZFAND7
Isotype: IgG
Interspecies mouse/rat: ,
Entrez Gene ID: 3508
Uniprot ID: P38935
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NRKGEVGFLAEDRRINVAVTRARRHVAVICDSRTVNNHAFLKTLVEYFTQHGEVRTAFEYLDDIVPENYSHENSQG |
Gene Sequence | NRKGEVGFLAEDRRINVAVTRARRHVAVICDSRTVNNHAFLKTLVEYFTQHGEVRTAFEYLDDIVPENYSHENSQG |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti IGHMBP2 pAb (ATL-HPA060994) | |
Datasheet | Anti IGHMBP2 pAb (ATL-HPA060994) Datasheet (External Link) |
Vendor Page | Anti IGHMBP2 pAb (ATL-HPA060994) at Atlas Antibodies |
Documents & Links for Anti IGHMBP2 pAb (ATL-HPA060994) | |
Datasheet | Anti IGHMBP2 pAb (ATL-HPA060994) Datasheet (External Link) |
Vendor Page | Anti IGHMBP2 pAb (ATL-HPA060994) |