Anti IGFBP4 pAb (ATL-HPA066240)

Atlas Antibodies

Catalog No: ATL-HPA066240-25

• 

Product Description

Protein Description: insulin-like growth factor binding protein 4
Gene Name: IGFBP4
Alternative Gene Name: BP-4, HT29-IGFBP, IBP4, IGFBP-4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017493: 96%, ENSRNOG00000010635: 95%
Entrez Gene ID: 3487
Uniprot ID: P22692
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EDARPVPQGSCQSELHRALERLAASQSRTHEDLYIIPIPNCDRNGNFHPKQCHPALDGQRGKCWCVDRKTGVKLPGGLEPKGELDCHQLADSFRE
• Gene Sequence: EDARPVPQGSCQSELHRALERLAASQSRTHEDLYIIPIPNCDRNGNFHPKQCHPALDGQRGKCWCVDRKTGVKLPGGLEPKGELDCHQLADSFRE
• Gene ID - Mouse: ENSMUSG00000017493
• Gene ID - Rat: ENSRNOG00000010635
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.