Protein Description: insulin-like growth factor binding protein 4
Gene Name: IGFBP4
Alternative Gene Name: BP-4, HT29-IGFBP, IBP4, IGFBP-4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017493: 96%, ENSRNOG00000010635: 95%
Entrez Gene ID: 3487
Uniprot ID: P22692
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: IGFBP4
Alternative Gene Name: BP-4, HT29-IGFBP, IBP4, IGFBP-4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017493: 96%, ENSRNOG00000010635: 95%
Entrez Gene ID: 3487
Uniprot ID: P22692
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | EDARPVPQGSCQSELHRALERLAASQSRTHEDLYIIPIPNCDRNGNFHPKQCHPALDGQRGKCWCVDRKTGVKLPGGLEPKGELDCHQLADSFRE |
Documents & Links for Anti IGFBP4 pAb (ATL-HPA066240) | |
Datasheet | Anti IGFBP4 pAb (ATL-HPA066240) Datasheet (External Link) |
Vendor Page | Anti IGFBP4 pAb (ATL-HPA066240) at Atlas |
Documents & Links for Anti IGFBP4 pAb (ATL-HPA066240) | |
Datasheet | Anti IGFBP4 pAb (ATL-HPA066240) Datasheet (External Link) |
Vendor Page | Anti IGFBP4 pAb (ATL-HPA066240) |