Description
Product Description
Protein Description: insulin-like growth factor 2 mRNA binding protein 1
Gene Name: IGF2BP1
Alternative Gene Name: IMP-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000013415: 96%, ENSRNOG00000006122: 100%
Entrez Gene ID: 10642
Uniprot ID: Q9NZI8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: IGF2BP1
Alternative Gene Name: IMP-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000013415: 96%, ENSRNOG00000006122: 100%
Entrez Gene ID: 10642
Uniprot ID: Q9NZI8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | HALKVSYIPDEQIAQGPENGRRGGFGSRGQPRQGSPVAAGAPAKQQQVDI |
Gene Sequence | HALKVSYIPDEQIAQGPENGRRGGFGSRGQPRQGSPVAAGAPAKQQQVDI |
Gene ID - Mouse | ENSMUSG00000013415 |
Gene ID - Rat | ENSRNOG00000006122 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti IGF2BP1 pAb (ATL-HPA062273 w/enhanced validation) | |
Datasheet | Anti IGF2BP1 pAb (ATL-HPA062273 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti IGF2BP1 pAb (ATL-HPA062273 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti IGF2BP1 pAb (ATL-HPA062273 w/enhanced validation) | |
Datasheet | Anti IGF2BP1 pAb (ATL-HPA062273 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti IGF2BP1 pAb (ATL-HPA062273 w/enhanced validation) |
Citations
Citations for Anti IGF2BP1 pAb (ATL-HPA062273 w/enhanced validation) – 1 Found |
Zhang, Huijuan; Hu, Jing; Liu, Aina; Qu, Huajun; Jiang, Fenge; Wang, Congcong; Mo, Steven; Sun, Ping. An N6-Methyladenosine-Related Gene Set Variation Score as a Prognostic Tool for Lung Adenocarcinoma. Frontiers In Cell And Developmental Biology. 9( 34307344):651575. PubMed |