Anti IGF2BP1 pAb (ATL-HPA062273 w/enhanced validation)

Catalog No:
ATL-HPA062273-25
$395.00

Description

Product Description

Protein Description: insulin-like growth factor 2 mRNA binding protein 1
Gene Name: IGF2BP1
Alternative Gene Name: IMP-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000013415: 96%, ENSRNOG00000006122: 100%
Entrez Gene ID: 10642
Uniprot ID: Q9NZI8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HALKVSYIPDEQIAQGPENGRRGGFGSRGQPRQGSPVAAGAPAKQQQVDI
Gene Sequence HALKVSYIPDEQIAQGPENGRRGGFGSRGQPRQGSPVAAGAPAKQQQVDI
Gene ID - Mouse ENSMUSG00000013415
Gene ID - Rat ENSRNOG00000006122
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links


Documents & Links for Anti IGF2BP1 pAb (ATL-HPA062273 w/enhanced validation)
Datasheet Anti IGF2BP1 pAb (ATL-HPA062273 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti IGF2BP1 pAb (ATL-HPA062273 w/enhanced validation)

Citations

Citations for Anti IGF2BP1 pAb (ATL-HPA062273 w/enhanced validation) – 1 Found
Zhang, Huijuan; Hu, Jing; Liu, Aina; Qu, Huajun; Jiang, Fenge; Wang, Congcong; Mo, Steven; Sun, Ping. An N6-Methyladenosine-Related Gene Set Variation Score as a Prognostic Tool for Lung Adenocarcinoma. Frontiers In Cell And Developmental Biology. 9( 34307344):651575.  PubMed

Product Description

Protein Description: insulin-like growth factor 2 mRNA binding protein 1
Gene Name: IGF2BP1
Alternative Gene Name: IMP-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000013415: 96%, ENSRNOG00000006122: 100%
Entrez Gene ID: 10642
Uniprot ID: Q9NZI8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HALKVSYIPDEQIAQGPENGRRGGFGSRGQPRQGSPVAAGAPAKQQQVDI
Gene Sequence HALKVSYIPDEQIAQGPENGRRGGFGSRGQPRQGSPVAAGAPAKQQQVDI
Gene ID - Mouse ENSMUSG00000013415
Gene ID - Rat ENSRNOG00000006122
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links


Documents & Links for Anti IGF2BP1 pAb (ATL-HPA062273 w/enhanced validation)
Datasheet Anti IGF2BP1 pAb (ATL-HPA062273 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti IGF2BP1 pAb (ATL-HPA062273 w/enhanced validation)

Citations

Citations for Anti IGF2BP1 pAb (ATL-HPA062273 w/enhanced validation) – 1 Found
Zhang, Huijuan; Hu, Jing; Liu, Aina; Qu, Huajun; Jiang, Fenge; Wang, Congcong; Mo, Steven; Sun, Ping. An N6-Methyladenosine-Related Gene Set Variation Score as a Prognostic Tool for Lung Adenocarcinoma. Frontiers In Cell And Developmental Biology. 9( 34307344):651575.  PubMed