Description
Product Description
Protein Description: interferon-related developmental regulator 2
Gene Name: IFRD2
Alternative Gene Name: IFNRP, SKMc15, SM15
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000010048: 84%, ENSRNOG00000016150: 85%
Entrez Gene ID: 7866
Uniprot ID: Q12894
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: IFRD2
Alternative Gene Name: IFNRP, SKMc15, SM15
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000010048: 84%, ENSRNOG00000016150: 85%
Entrez Gene ID: 7866
Uniprot ID: Q12894
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | CLACLESVFSRFYGLGGSSTSPVVPASLHGLLSAALQAWALLLTICPSTQISHILDRQLPRLPQLLSSESVNLRIAAGETIALLFE |
Gene Sequence | CLACLESVFSRFYGLGGSSTSPVVPASLHGLLSAALQAWALLLTICPSTQISHILDRQLPRLPQLLSSESVNLRIAAGETIALLFE |
Gene ID - Mouse | ENSMUSG00000010048 |
Gene ID - Rat | ENSRNOG00000016150 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti IFRD2 pAb (ATL-HPA068560) | |
Datasheet | Anti IFRD2 pAb (ATL-HPA068560) Datasheet (External Link) |
Vendor Page | Anti IFRD2 pAb (ATL-HPA068560) at Atlas Antibodies |
Documents & Links for Anti IFRD2 pAb (ATL-HPA068560) | |
Datasheet | Anti IFRD2 pAb (ATL-HPA068560) Datasheet (External Link) |
Vendor Page | Anti IFRD2 pAb (ATL-HPA068560) |