Anti IFNGR1 pAb (ATL-HPA063871)

Catalog No:
ATL-HPA063871-25
$395.00

Description

Product Description

Protein Description: interferon gamma receptor 1
Gene Name: IFNGR1
Alternative Gene Name: CD119, IFNGR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020009: 54%, ENSRNOG00000012074: 53%
Entrez Gene ID: 3459
Uniprot ID: P15260
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SSVPTPTNVTIESYNMNPIVYWEYQIMPQVPVFTVEVKNYGVKNSEWIDACINISHHYCNISDHVGDPSNSL
Gene Sequence SSVPTPTNVTIESYNMNPIVYWEYQIMPQVPVFTVEVKNYGVKNSEWIDACINISHHYCNISDHVGDPSNSL
Gene ID - Mouse ENSMUSG00000020009
Gene ID - Rat ENSRNOG00000012074
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti IFNGR1 pAb (ATL-HPA063871)
Datasheet Anti IFNGR1 pAb (ATL-HPA063871) Datasheet (External Link)
Vendor Page Anti IFNGR1 pAb (ATL-HPA063871) at Atlas Antibodies

Documents & Links for Anti IFNGR1 pAb (ATL-HPA063871)
Datasheet Anti IFNGR1 pAb (ATL-HPA063871) Datasheet (External Link)
Vendor Page Anti IFNGR1 pAb (ATL-HPA063871)

Product Description

Protein Description: interferon gamma receptor 1
Gene Name: IFNGR1
Alternative Gene Name: CD119, IFNGR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020009: 54%, ENSRNOG00000012074: 53%
Entrez Gene ID: 3459
Uniprot ID: P15260
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SSVPTPTNVTIESYNMNPIVYWEYQIMPQVPVFTVEVKNYGVKNSEWIDACINISHHYCNISDHVGDPSNSL
Gene Sequence SSVPTPTNVTIESYNMNPIVYWEYQIMPQVPVFTVEVKNYGVKNSEWIDACINISHHYCNISDHVGDPSNSL
Gene ID - Mouse ENSMUSG00000020009
Gene ID - Rat ENSRNOG00000012074
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti IFNGR1 pAb (ATL-HPA063871)
Datasheet Anti IFNGR1 pAb (ATL-HPA063871) Datasheet (External Link)
Vendor Page Anti IFNGR1 pAb (ATL-HPA063871) at Atlas Antibodies

Documents & Links for Anti IFNGR1 pAb (ATL-HPA063871)
Datasheet Anti IFNGR1 pAb (ATL-HPA063871) Datasheet (External Link)
Vendor Page Anti IFNGR1 pAb (ATL-HPA063871)