Protein Description: interferon gamma receptor 1
Gene Name: IFNGR1
Alternative Gene Name: CD119, IFNGR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020009: 54%, ENSRNOG00000012074: 53%
Entrez Gene ID: 3459
Uniprot ID: P15260
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: IFNGR1
Alternative Gene Name: CD119, IFNGR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020009: 54%, ENSRNOG00000012074: 53%
Entrez Gene ID: 3459
Uniprot ID: P15260
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | SSVPTPTNVTIESYNMNPIVYWEYQIMPQVPVFTVEVKNYGVKNSEWIDACINISHHYCNISDHVGDPSNSL |
| Documents & Links for Anti IFNGR1 pAb (ATL-HPA063871) | |
| Datasheet | Anti IFNGR1 pAb (ATL-HPA063871) Datasheet (External Link) |
| Vendor Page | Anti IFNGR1 pAb (ATL-HPA063871) at Atlas |
| Documents & Links for Anti IFNGR1 pAb (ATL-HPA063871) | |
| Datasheet | Anti IFNGR1 pAb (ATL-HPA063871) Datasheet (External Link) |
| Vendor Page | Anti IFNGR1 pAb (ATL-HPA063871) |