Protein Description: interferon beta 1
Gene Name: IFNB1
Alternative Gene Name: IFB, IFF, IFNB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048806: 45%, ENSRNOG00000006268: 50%
Entrez Gene ID: 3456
Uniprot ID: P01574
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: IFNB1
Alternative Gene Name: IFB, IFF, IFNB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048806: 45%, ENSRNOG00000006268: 50%
Entrez Gene ID: 3456
Uniprot ID: P01574
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | YNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWN |
| Documents & Links for Anti IFNB1 pAb (ATL-HPA073843) | |
| Datasheet | Anti IFNB1 pAb (ATL-HPA073843) Datasheet (External Link) |
| Vendor Page | Anti IFNB1 pAb (ATL-HPA073843) at Atlas |
| Documents & Links for Anti IFNB1 pAb (ATL-HPA073843) | |
| Datasheet | Anti IFNB1 pAb (ATL-HPA073843) Datasheet (External Link) |
| Vendor Page | Anti IFNB1 pAb (ATL-HPA073843) |