Anti IFIT1B pAb (ATL-HPA062924)

Atlas Antibodies

Catalog No: ATL-HPA062924-25

• 

Product Description

Protein Description: interferon-induced protein with tetratricopeptide repeats 1B
Gene Name: IFIT1B
Alternative Gene Name: bA149I23.6, IFIT1L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079339: 58%, ENSRNOG00000019050: 66%
Entrez Gene ID: 439996
Uniprot ID: Q5T764
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RFQEHHGKSQDKAITHYLKGLKIEKMSHSREKLLNALEKLAKRCIHQNVR
• Gene Sequence: RFQEHHGKSQDKAITHYLKGLKIEKMSHSREKLLNALEKLAKRCIHQNVR
• Gene ID - Mouse: ENSMUSG00000079339
• Gene ID - Rat: ENSRNOG00000019050
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.