![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/101497/181616/atl-hpa075580_anti-ifi35-pab-atl-hpa075580_63284__06884.1681137983.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil")
Protein Description: interferon induced protein 35
Gene Name: IFI35
Alternative Gene Name: IFP35
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000010358: 63%, ENSRNOG00000020678: 64%
Entrez Gene ID: 3430
Uniprot ID: P80217
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: IFI35
Alternative Gene Name: IFP35
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000010358: 63%, ENSRNOG00000020678: 64%
Entrez Gene ID: 3430
Uniprot ID: P80217
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | QARLKMRLWDLQQLRKELGDSPKDKVPFSVPKIPLVFRGHTQQDPEVPKSLVSNLRIHCPLLAGSALITFDD |
| Documents & Links for Anti IFI35 pAb (ATL-HPA075580) | |
| Datasheet | Anti IFI35 pAb (ATL-HPA075580) Datasheet (External Link) |
| Vendor Page | Anti IFI35 pAb (ATL-HPA075580) at Atlas |
| Documents & Links for Anti IFI35 pAb (ATL-HPA075580) | |
| Datasheet | Anti IFI35 pAb (ATL-HPA075580) Datasheet (External Link) |
| Vendor Page | Anti IFI35 pAb (ATL-HPA075580) |