Description
Product Description
Protein Description: immediate early response 2
Gene Name: IER2
Alternative Gene Name: ETR101
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053560: 83%, ENSRNOG00000005038: 32%
Entrez Gene ID: 9592
Uniprot ID: Q9BTL4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: IER2
Alternative Gene Name: ETR101
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053560: 83%, ENSRNOG00000005038: 32%
Entrez Gene ID: 9592
Uniprot ID: Q9BTL4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DAGLVPSKKARLEEKEEEEGASSEVADRLQPPPAQAEGAFPNLARVLQRRFSGLLNCS |
| Gene Sequence | DAGLVPSKKARLEEKEEEEGASSEVADRLQPPPAQAEGAFPNLARVLQRRFSGLLNCS |
| Gene ID - Mouse | ENSMUSG00000053560 |
| Gene ID - Rat | ENSRNOG00000005038 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
| Documents & Links for Anti IER2 pAb (ATL-HPA060574) | |
| Datasheet | Anti IER2 pAb (ATL-HPA060574) Datasheet (External Link) |
| Vendor Page | Anti IER2 pAb (ATL-HPA060574) at Atlas Antibodies |
| Documents & Links for Anti IER2 pAb (ATL-HPA060574) | |
| Datasheet | Anti IER2 pAb (ATL-HPA060574) Datasheet (External Link) |
| Vendor Page | Anti IER2 pAb (ATL-HPA060574) |