Protein Description: iduronate 2-sulfatase
Gene Name: IDS
Alternative Gene Name: SIDS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035847: 98%, ENSRNOG00000001465: 98%
Entrez Gene ID: 3423
Uniprot ID: P22304
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: IDS
Alternative Gene Name: SIDS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035847: 98%, ENSRNOG00000001465: 98%
Entrez Gene ID: 3423
Uniprot ID: P22304
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | TGRRPDTTRLYDFNSYWRVHAGNFSTIPQYFKENGYVTMSVG |
| Documents & Links for Anti IDS pAb (ATL-HPA078003) | |
| Datasheet | Anti IDS pAb (ATL-HPA078003) Datasheet (External Link) |
| Vendor Page | Anti IDS pAb (ATL-HPA078003) at Atlas |
| Documents & Links for Anti IDS pAb (ATL-HPA078003) | |
| Datasheet | Anti IDS pAb (ATL-HPA078003) Datasheet (External Link) |
| Vendor Page | Anti IDS pAb (ATL-HPA078003) |