Anti IDO1 pAb (ATL-HPA023149 w/enhanced validation)

Atlas

Catalog No: ATL-HPA023149-25

• 
• 

Protein Description: indoleamine 2,3-dioxygenase 1
Gene Name: IDO1
Alternative Gene Name: IDO, INDO
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031551: 48%, ENSRNOG00000031189: 54%
Entrez Gene ID: 3620
Uniprot ID: P14902
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Gene Sequence: LCSLESNPSVREFVLSKGDAGLREAYDACVKALVSLRSYHLQIVTKYILIPASQQPKENKTSEDPSKLEAKGTGGTDLMNFLK

Citations for Anti IDO1 pAb (ATL-HPA023149 w/enhanced validation) – 3 Found

Ji, Rong; Ma, Lixiang; Chen, Xinyu; Sun, Renqiang; Zhang, Li; Saiyin, Hexige; Wei, Wenshi. Characterizing the distributions of IDO-1 expressing macrophages/microglia in human and murine brains and evaluating the immunological and physiological roles of IDO-1 in RAW264.7/BV-2 cells. Plos One. 16(11):e0258204. 

Miao, Xiaofei; Zhang, Ye; Li, Zengyao; Huang, Longchang; Xin, Taojian; Shen, Renhui; Wang, Tong. Inhibition of indoleamine 2,3-dioxygenase 1 synergizes with oxaliplatin for efficient colorectal cancer therapy. Molecular Therapy. Methods & Clinical Development. 2021;20( 33665222):442-450. 

Abdulla, Maysaa; Sundström, Christer; Lindskog, Cecilia; Hollander, Peter. Expression of IDO1 and PD-L2 in Patients with Benign Lymphadenopathies and Association with Autoimmune Diseases. Biomolecules. 2023;13(2)