Anti IDH3A pAb (ATL-HPA062971 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA062971-100

• 
• 

Product Description

Protein Description: isocitrate dehydrogenase 3 (NAD+) alpha
Gene Name: IDH3A
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032279: 100%, ENSRNOG00000010277: 100%
Entrez Gene ID: 3419
Uniprot ID: P50213
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NKMGLKGPLKTPIAAGHPSMNLLLRKTFDLYANVRPCVSIEGYKTPYTDVNIVTI
• Gene Sequence: NKMGLKGPLKTPIAAGHPSMNLLLRKTFDLYANVRPCVSIEGYKTPYTDVNIVTI
• Gene ID - Mouse: ENSMUSG00000032279
• Gene ID - Rat: ENSRNOG00000010277
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.