Protein Description: isocitrate dehydrogenase 3 (NAD+) alpha
Gene Name: IDH3A
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032279: 100%, ENSRNOG00000010277: 100%
Entrez Gene ID: 3419
Uniprot ID: P50213
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: IDH3A
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032279: 100%, ENSRNOG00000010277: 100%
Entrez Gene ID: 3419
Uniprot ID: P50213
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | NKMGLKGPLKTPIAAGHPSMNLLLRKTFDLYANVRPCVSIEGYKTPYTDVNIVTI |
Documents & Links for Anti IDH3A pAb (ATL-HPA062971 w/enhanced validation) | |
Datasheet | Anti IDH3A pAb (ATL-HPA062971 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti IDH3A pAb (ATL-HPA062971 w/enhanced validation) at Atlas |
Documents & Links for Anti IDH3A pAb (ATL-HPA062971 w/enhanced validation) | |
Datasheet | Anti IDH3A pAb (ATL-HPA062971 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti IDH3A pAb (ATL-HPA062971 w/enhanced validation) |