Description
Product Description
Protein Description: HYDIN, axonemal central pair apparatus protein
Gene Name: HYDIN
Alternative Gene Name: CILD5, DKFZp434D0513, KIAA1864, PPP1R31
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059854: 63%, ENSRNOG00000017178: 59%
Entrez Gene ID: 54768
Uniprot ID: Q4G0P3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: HYDIN
Alternative Gene Name: CILD5, DKFZp434D0513, KIAA1864, PPP1R31
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059854: 63%, ENSRNOG00000017178: 59%
Entrez Gene ID: 54768
Uniprot ID: Q4G0P3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VGQNVIGQGRLSTDTLGKLASEMTLVAPEIKPGKSVRGSVVITKSKADSHGSGSQKQHHSHQSETPQISSSPLPPGPIHRWLSVSPSVG |
Gene Sequence | VGQNVIGQGRLSTDTLGKLASEMTLVAPEIKPGKSVRGSVVITKSKADSHGSGSQKQHHSHQSETPQISSSPLPPGPIHRWLSVSPSVG |
Gene ID - Mouse | ENSMUSG00000059854 |
Gene ID - Rat | ENSRNOG00000017178 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti HYDIN pAb (ATL-HPA074129) | |
Datasheet | Anti HYDIN pAb (ATL-HPA074129) Datasheet (External Link) |
Vendor Page | Anti HYDIN pAb (ATL-HPA074129) at Atlas Antibodies |
Documents & Links for Anti HYDIN pAb (ATL-HPA074129) | |
Datasheet | Anti HYDIN pAb (ATL-HPA074129) Datasheet (External Link) |
Vendor Page | Anti HYDIN pAb (ATL-HPA074129) |