Protein Description: huntingtin
Gene Name: HTT
Alternative Gene Name: HD, IT15
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029104: 82%, ENSRNOG00000011073: 85%
Entrez Gene ID: 3064
Uniprot ID: P42858
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: HTT
Alternative Gene Name: HD, IT15
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029104: 82%, ENSRNOG00000011073: 85%
Entrez Gene ID: 3064
Uniprot ID: P42858
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LQQAHLLKNMSHCRQPSDSSVDKFVLRDEATEPGDQENKPCRIKGDIGQSTDDDSAPLVHCVRLLSASFLLTGGKNVLVPDRDVRVSVKALALSCVGAAVALHPESFFSKLYKVPLD |
| Documents & Links for Anti HTT pAb (ATL-HPA026114 w/enhanced validation) | |
| Datasheet | Anti HTT pAb (ATL-HPA026114 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti HTT pAb (ATL-HPA026114 w/enhanced validation) at Atlas |
| Documents & Links for Anti HTT pAb (ATL-HPA026114 w/enhanced validation) | |
| Datasheet | Anti HTT pAb (ATL-HPA026114 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti HTT pAb (ATL-HPA026114 w/enhanced validation) |