Protein Description: HtrA serine peptidase 3
Gene Name: HTRA3
Alternative Gene Name: Prsp, Tasp
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029096: 89%, ENSRNOG00000008182: 85%
Entrez Gene ID: 94031
Uniprot ID: P83110
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: HTRA3
Alternative Gene Name: Prsp, Tasp
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029096: 89%, ENSRNOG00000008182: 85%
Entrez Gene ID: 94031
Uniprot ID: P83110
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | NAHVVSSNSAAPGRQQLKVQLQNGDSYEATIKDIDKKSDIATIKIHPKKKLPVL |
| Documents & Links for Anti HTRA3 pAb (ATL-HPA063810) | |
| Datasheet | Anti HTRA3 pAb (ATL-HPA063810) Datasheet (External Link) |
| Vendor Page | Anti HTRA3 pAb (ATL-HPA063810) at Atlas |
| Documents & Links for Anti HTRA3 pAb (ATL-HPA063810) | |
| Datasheet | Anti HTRA3 pAb (ATL-HPA063810) Datasheet (External Link) |
| Vendor Page | Anti HTRA3 pAb (ATL-HPA063810) |