Protein Description: HtrA serine peptidase 1
Gene Name: HTRA1
Alternative Gene Name: ARMD7, HtrA, IGFBP5-protease, PRSS11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006205: 91%, ENSRNOG00000020533: 91%
Entrez Gene ID: 5654
Uniprot ID: Q92743
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: HTRA1
Alternative Gene Name: ARMD7, HtrA, IGFBP5-protease, PRSS11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006205: 91%, ENSRNOG00000020533: 91%
Entrez Gene ID: 5654
Uniprot ID: Q92743
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | GSDANTYANLCQLRAASRRSERLHRPPVIVLQRGACGQGQEDPNSLRHKYNFIA |
| Documents & Links for Anti HTRA1 pAb (ATL-HPA036655) | |
| Datasheet | Anti HTRA1 pAb (ATL-HPA036655) Datasheet (External Link) |
| Vendor Page | Anti HTRA1 pAb (ATL-HPA036655) at Atlas |
| Documents & Links for Anti HTRA1 pAb (ATL-HPA036655) | |
| Datasheet | Anti HTRA1 pAb (ATL-HPA036655) Datasheet (External Link) |
| Vendor Page | Anti HTRA1 pAb (ATL-HPA036655) |
| Citations for Anti HTRA1 pAb (ATL-HPA036655) – 2 Found |
| Ziaei, Amin; Xu, Xiaohong; Dehghani, Leila; Bonnard, Carine; Zellner, Andreas; Jin Ng, Alvin Yu; Tohari, Sumanty; Venkatesh, Byrappa; Haffner, Christof; Reversade, Bruno; Shaygannejad, Vahid; Pouladi, Mahmoud A. Novel mutation in HTRA1 in a family with diffuse white matter lesions and inflammatory features. Neurology. Genetics. 2019;5(4):e345. PubMed |
| Wang, Ning; Eckert, Kristin A; Zomorrodi, Ali R; Xin, Ping; Pan, Weihua; Shearer, Debra A; Weisz, Judith; Maranus, Costas D; Clawson, Gary A. Down-regulation of HtrA1 activates the epithelial-mesenchymal transition and ATM DNA damage response pathways. Plos One. 7(6):e39446. PubMed |