Protein Description: 5-hydroxytryptamine receptor 7
Gene Name: HTR7
Alternative Gene Name: 5-HT7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024798: 61%, ENSRNOG00000055705: 59%
Entrez Gene ID: 3363
Uniprot ID: P34969
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: HTR7
Alternative Gene Name: 5-HT7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024798: 61%, ENSRNOG00000055705: 59%
Entrez Gene ID: 3363
Uniprot ID: P34969
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | NRDLRTTYRSLLQCQYRNINRKLSAAGMHEALKLAERPERPEFVLRACTRRVLLRPEKRPPVSVWVLQSPDHHN |
Documents & Links for Anti HTR7 pAb (ATL-HPA073617) | |
Datasheet | Anti HTR7 pAb (ATL-HPA073617) Datasheet (External Link) |
Vendor Page | Anti HTR7 pAb (ATL-HPA073617) at Atlas |
Documents & Links for Anti HTR7 pAb (ATL-HPA073617) | |
Datasheet | Anti HTR7 pAb (ATL-HPA073617) Datasheet (External Link) |
Vendor Page | Anti HTR7 pAb (ATL-HPA073617) |