Description
Product Description
Protein Description: 5-hydroxytryptamine receptor 3A
Gene Name: HTR3A
Alternative Gene Name: 5-HT3A, 5-HT3R, HTR3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032269: 81%, ENSRNOG00000006595: 78%
Entrez Gene ID: 3359
Uniprot ID: P46098
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: HTR3A
Alternative Gene Name: 5-HT3A, 5-HT3R, HTR3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032269: 81%, ENSRNOG00000006595: 78%
Entrez Gene ID: 3359
Uniprot ID: P46098
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LRHLVLERIAWLLCLREQSTSQRPPATSQATKTDDCSAMGNHCSHMGGPQDFEKSPRDRCSPPPPPREASLAVCGLLQELSSIRQFLEKRDEI |
Gene Sequence | LRHLVLERIAWLLCLREQSTSQRPPATSQATKTDDCSAMGNHCSHMGGPQDFEKSPRDRCSPPPPPREASLAVCGLLQELSSIRQFLEKRDEI |
Gene ID - Mouse | ENSMUSG00000032269 |
Gene ID - Rat | ENSRNOG00000006595 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti HTR3A pAb (ATL-HPA069442) | |
Datasheet | Anti HTR3A pAb (ATL-HPA069442) Datasheet (External Link) |
Vendor Page | Anti HTR3A pAb (ATL-HPA069442) at Atlas Antibodies |
Documents & Links for Anti HTR3A pAb (ATL-HPA069442) | |
Datasheet | Anti HTR3A pAb (ATL-HPA069442) Datasheet (External Link) |
Vendor Page | Anti HTR3A pAb (ATL-HPA069442) |