Protein Description: 5-hydroxytryptamine receptor 3A
Gene Name: HTR3A
Alternative Gene Name: 5-HT3A, 5-HT3R, HTR3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032269: 81%, ENSRNOG00000006595: 78%
Entrez Gene ID: 3359
Uniprot ID: P46098
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: HTR3A
Alternative Gene Name: 5-HT3A, 5-HT3R, HTR3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032269: 81%, ENSRNOG00000006595: 78%
Entrez Gene ID: 3359
Uniprot ID: P46098
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LRHLVLERIAWLLCLREQSTSQRPPATSQATKTDDCSAMGNHCSHMGGPQDFEKSPRDRCSPPPPPREASLAVCGLLQELSSIRQFLEKRDEI |
| Documents & Links for Anti HTR3A pAb (ATL-HPA069442) | |
| Datasheet | Anti HTR3A pAb (ATL-HPA069442) Datasheet (External Link) |
| Vendor Page | Anti HTR3A pAb (ATL-HPA069442) at Atlas |
| Documents & Links for Anti HTR3A pAb (ATL-HPA069442) | |
| Datasheet | Anti HTR3A pAb (ATL-HPA069442) Datasheet (External Link) |
| Vendor Page | Anti HTR3A pAb (ATL-HPA069442) |