Description
Product Description
Protein Description: 5-hydroxytryptamine (serotonin) receptor 2B, G protein-coupled
Gene Name: HTR2B
Alternative Gene Name: 5-HT(2B), 5-HT2B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026228: 86%, ENSRNOG00000017625: 84%
Entrez Gene ID: 3357
Uniprot ID: P41595
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: HTR2B
Alternative Gene Name: 5-HT(2B), 5-HT2B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026228: 86%, ENSRNOG00000017625: 84%
Entrez Gene ID: 3357
Uniprot ID: P41595
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RYITCNYRATKSVKTLRKRSSKIYFRNPMAENSKFFKKHGIRNGINPAMYQSPMRLRSSTIQS |
Gene Sequence | RYITCNYRATKSVKTLRKRSSKIYFRNPMAENSKFFKKHGIRNGINPAMYQSPMRLRSSTIQS |
Gene ID - Mouse | ENSMUSG00000026228 |
Gene ID - Rat | ENSRNOG00000017625 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti HTR2B pAb (ATL-HPA063658) | |
Datasheet | Anti HTR2B pAb (ATL-HPA063658) Datasheet (External Link) |
Vendor Page | Anti HTR2B pAb (ATL-HPA063658) at Atlas Antibodies |
Documents & Links for Anti HTR2B pAb (ATL-HPA063658) | |
Datasheet | Anti HTR2B pAb (ATL-HPA063658) Datasheet (External Link) |
Vendor Page | Anti HTR2B pAb (ATL-HPA063658) |