Description
Product Description
Protein Description: hydroxyacyl-thioester dehydratase type 2
Gene Name: HTD2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023156: 60%, ENSRNOG00000013451: 27%
Entrez Gene ID: 109703458
Uniprot ID: P86397
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: HTD2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023156: 60%, ENSRNOG00000013451: 27%
Entrez Gene ID: 109703458
Uniprot ID: P86397
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MFPLISSHHLWWGGLRRTVCLNLPVLTLQHFQHMHIKVGDRAELRRAFTQTDVATFSELTGDVNPLHLNEDFAKHTKFGNTLV |
Gene Sequence | MFPLISSHHLWWGGLRRTVCLNLPVLTLQHFQHMHIKVGDRAELRRAFTQTDVATFSELTGDVNPLHLNEDFAKHTKFGNTLV |
Gene ID - Mouse | ENSMUSG00000023156 |
Gene ID - Rat | ENSRNOG00000013451 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti HTD2 pAb (ATL-HPA077228) | |
Datasheet | Anti HTD2 pAb (ATL-HPA077228) Datasheet (External Link) |
Vendor Page | Anti HTD2 pAb (ATL-HPA077228) at Atlas Antibodies |
Documents & Links for Anti HTD2 pAb (ATL-HPA077228) | |
Datasheet | Anti HTD2 pAb (ATL-HPA077228) Datasheet (External Link) |
Vendor Page | Anti HTD2 pAb (ATL-HPA077228) |