Anti HTD2 pAb (ATL-HPA077228)

Catalog No:
ATL-HPA077228-25
$447.00
Protein Description: hydroxyacyl-thioester dehydratase type 2
Gene Name: HTD2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023156: 60%, ENSRNOG00000013451: 27%
Entrez Gene ID: 109703458
Uniprot ID: P86397
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence MFPLISSHHLWWGGLRRTVCLNLPVLTLQHFQHMHIKVGDRAELRRAFTQTDVATFSELTGDVNPLHLNEDFAKHTKFGNTLV
Gene ID - Mouse ENSMUSG00000023156
Gene ID - Rat ENSMUSG00000023156
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Documents & Links for Anti HTD2 pAb (ATL-HPA077228)
Datasheet Anti HTD2 pAb (ATL-HPA077228) Datasheet (External Link)
Vendor Page Anti HTD2 pAb (ATL-HPA077228) at Atlas

Documents & Links for Anti HTD2 pAb (ATL-HPA077228)
Datasheet Anti HTD2 pAb (ATL-HPA077228) Datasheet (External Link)
Vendor Page Anti HTD2 pAb (ATL-HPA077228)