Protein Description: hydroxyacyl-thioester dehydratase type 2
Gene Name: HTD2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023156: 60%, ENSRNOG00000013451: 27%
Entrez Gene ID: 109703458
Uniprot ID: P86397
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: HTD2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023156: 60%, ENSRNOG00000013451: 27%
Entrez Gene ID: 109703458
Uniprot ID: P86397
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | MFPLISSHHLWWGGLRRTVCLNLPVLTLQHFQHMHIKVGDRAELRRAFTQTDVATFSELTGDVNPLHLNEDFAKHTKFGNTLV |
| Gene ID - Mouse | ENSMUSG00000023156 |
| Gene ID - Rat | ENSMUSG00000023156 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti HTD2 pAb (ATL-HPA077228) | |
| Datasheet | Anti HTD2 pAb (ATL-HPA077228) Datasheet (External Link) |
| Vendor Page | Anti HTD2 pAb (ATL-HPA077228) at Atlas |
| Documents & Links for Anti HTD2 pAb (ATL-HPA077228) | |
| Datasheet | Anti HTD2 pAb (ATL-HPA077228) Datasheet (External Link) |
| Vendor Page | Anti HTD2 pAb (ATL-HPA077228) |