Protein Description: heparan sulfate proteoglycan 2
Gene Name: HSPG2
Alternative Gene Name: perlecan, PRCAN, SJS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028763: 88%, ENSRNOG00000021437: 88%
Entrez Gene ID: 3339
Uniprot ID: P98160
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: HSPG2
Alternative Gene Name: perlecan, PRCAN, SJS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028763: 88%, ENSRNOG00000021437: 88%
Entrez Gene ID: 3339
Uniprot ID: P98160
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | RGMVFGIPDGVLELVPQRGPCPDGHFYLEHSAACLPCFCFGITSVCQSTRRFRDQIRLRFDQPDDFKGVNVTMPAQPGTPPLSSTQLQIDPSL |
Documents & Links for Anti HSPG2 pAb (ATL-HPA072690) | |
Datasheet | Anti HSPG2 pAb (ATL-HPA072690) Datasheet (External Link) |
Vendor Page | Anti HSPG2 pAb (ATL-HPA072690) at Atlas |
Documents & Links for Anti HSPG2 pAb (ATL-HPA072690) | |
Datasheet | Anti HSPG2 pAb (ATL-HPA072690) Datasheet (External Link) |
Vendor Page | Anti HSPG2 pAb (ATL-HPA072690) |