Description
Product Description
Protein Description: HSPA (heat shock 70kDa) binding protein, cytoplasmic cochaperone 1
Gene Name: HSPBP1
Alternative Gene Name: FES1, HspBP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063802: 99%, ENSRNOG00000017795: 100%
Entrez Gene ID: 23640
Uniprot ID: Q9NZL4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: HSPBP1
Alternative Gene Name: FES1, HspBP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063802: 99%, ENSRNOG00000017795: 100%
Entrez Gene ID: 23640
Uniprot ID: Q9NZL4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KLKVKSAFLLQNLLVGHPEHKGTLCSMGMVQQLVALVRTEHSPFHEHVLGALCSLVTDFPQGVRECREPELGLEELLRHRCQLLQQHEEYQEELEFCEKLLQT |
Gene Sequence | KLKVKSAFLLQNLLVGHPEHKGTLCSMGMVQQLVALVRTEHSPFHEHVLGALCSLVTDFPQGVRECREPELGLEELLRHRCQLLQQHEEYQEELEFCEKLLQT |
Gene ID - Mouse | ENSMUSG00000063802 |
Gene ID - Rat | ENSRNOG00000017795 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti HSPBP1 pAb (ATL-HPA071444 w/enhanced validation) | |
Datasheet | Anti HSPBP1 pAb (ATL-HPA071444 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti HSPBP1 pAb (ATL-HPA071444 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti HSPBP1 pAb (ATL-HPA071444 w/enhanced validation) | |
Datasheet | Anti HSPBP1 pAb (ATL-HPA071444 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti HSPBP1 pAb (ATL-HPA071444 w/enhanced validation) |