Anti HSPBP1 pAb (ATL-HPA071444 w/enhanced validation)

Catalog No:
ATL-HPA071444-25
$447.00

Description

Product Description

Protein Description: HSPA (heat shock 70kDa) binding protein, cytoplasmic cochaperone 1
Gene Name: HSPBP1
Alternative Gene Name: FES1, HspBP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063802: 99%, ENSRNOG00000017795: 100%
Entrez Gene ID: 23640
Uniprot ID: Q9NZL4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KLKVKSAFLLQNLLVGHPEHKGTLCSMGMVQQLVALVRTEHSPFHEHVLGALCSLVTDFPQGVRECREPELGLEELLRHRCQLLQQHEEYQEELEFCEKLLQT
Gene Sequence KLKVKSAFLLQNLLVGHPEHKGTLCSMGMVQQLVALVRTEHSPFHEHVLGALCSLVTDFPQGVRECREPELGLEELLRHRCQLLQQHEEYQEELEFCEKLLQT
Gene ID - Mouse ENSMUSG00000063802
Gene ID - Rat ENSRNOG00000017795
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links


Documents & Links for Anti HSPBP1 pAb (ATL-HPA071444 w/enhanced validation)
Datasheet Anti HSPBP1 pAb (ATL-HPA071444 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HSPBP1 pAb (ATL-HPA071444 w/enhanced validation)

Product Description

Protein Description: HSPA (heat shock 70kDa) binding protein, cytoplasmic cochaperone 1
Gene Name: HSPBP1
Alternative Gene Name: FES1, HspBP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063802: 99%, ENSRNOG00000017795: 100%
Entrez Gene ID: 23640
Uniprot ID: Q9NZL4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KLKVKSAFLLQNLLVGHPEHKGTLCSMGMVQQLVALVRTEHSPFHEHVLGALCSLVTDFPQGVRECREPELGLEELLRHRCQLLQQHEEYQEELEFCEKLLQT
Gene Sequence KLKVKSAFLLQNLLVGHPEHKGTLCSMGMVQQLVALVRTEHSPFHEHVLGALCSLVTDFPQGVRECREPELGLEELLRHRCQLLQQHEEYQEELEFCEKLLQT
Gene ID - Mouse ENSMUSG00000063802
Gene ID - Rat ENSRNOG00000017795
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links


Documents & Links for Anti HSPBP1 pAb (ATL-HPA071444 w/enhanced validation)
Datasheet Anti HSPBP1 pAb (ATL-HPA071444 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HSPBP1 pAb (ATL-HPA071444 w/enhanced validation)