Anti HSPBP1 pAb (ATL-HPA070398)

Atlas Antibodies

Catalog No: ATL-HPA070398-100

• 
• 

Product Description

Protein Description: HSPA (Hsp70) binding protein 1
Gene Name: HSPBP1
Alternative Gene Name: FES1, HspBP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063802: 100%, ENSRNOG00000017795: 100%
Entrez Gene ID: 23640
Uniprot ID: Q9NZL4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LELLADLCENMDNAADFCQLSGMHLLVGRYLEAGAAGLRWRAAQLIGTCSQNVAAIQEQVL
• Gene Sequence: LELLADLCENMDNAADFCQLSGMHLLVGRYLEAGAAGLRWRAAQLIGTCSQNVAAIQEQVL
• Gene ID - Mouse: ENSMUSG00000063802
• Gene ID - Rat: ENSRNOG00000017795
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.