![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/100580/180501/atl-hpa070398_anti-hspbp1-pab-atl-hpa070398_62169__24533.1681136605.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil")
Protein Description: HSPA (Hsp70) binding protein 1
Gene Name: HSPBP1
Alternative Gene Name: FES1, HspBP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063802: 100%, ENSRNOG00000017795: 100%
Entrez Gene ID: 23640
Uniprot ID: Q9NZL4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: HSPBP1
Alternative Gene Name: FES1, HspBP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063802: 100%, ENSRNOG00000017795: 100%
Entrez Gene ID: 23640
Uniprot ID: Q9NZL4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LELLADLCENMDNAADFCQLSGMHLLVGRYLEAGAAGLRWRAAQLIGTCSQNVAAIQEQVL |
| Documents & Links for Anti HSPBP1 pAb (ATL-HPA070398) | |
| Datasheet | Anti HSPBP1 pAb (ATL-HPA070398) Datasheet (External Link) |
| Vendor Page | Anti HSPBP1 pAb (ATL-HPA070398) at Atlas |
| Documents & Links for Anti HSPBP1 pAb (ATL-HPA070398) | |
| Datasheet | Anti HSPBP1 pAb (ATL-HPA070398) Datasheet (External Link) |
| Vendor Page | Anti HSPBP1 pAb (ATL-HPA070398) |