Description
Product Description
Protein Description: heat shock 70kDa protein 12A
Gene Name: HSPA12A
Alternative Gene Name: FLJ13874, KIAA0417
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025092: 85%, ENSRNOG00000018019: 87%
Entrez Gene ID: 259217
Uniprot ID: O43301
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: HSPA12A
Alternative Gene Name: FLJ13874, KIAA0417
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025092: 85%, ENSRNOG00000018019: 87%
Entrez Gene ID: 259217
Uniprot ID: O43301
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MADKEAGGSDGPRETAPTSAYSSPARSLGDTGITPLSPSHIVNDTDSNVSEQQSFLVVVAV |
Gene Sequence | MADKEAGGSDGPRETAPTSAYSSPARSLGDTGITPLSPSHIVNDTDSNVSEQQSFLVVVAV |
Gene ID - Mouse | ENSMUSG00000025092 |
Gene ID - Rat | ENSRNOG00000018019 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti HSPA12A pAb (ATL-HPA073244) | |
Datasheet | Anti HSPA12A pAb (ATL-HPA073244) Datasheet (External Link) |
Vendor Page | Anti HSPA12A pAb (ATL-HPA073244) at Atlas Antibodies |
Documents & Links for Anti HSPA12A pAb (ATL-HPA073244) | |
Datasheet | Anti HSPA12A pAb (ATL-HPA073244) Datasheet (External Link) |
Vendor Page | Anti HSPA12A pAb (ATL-HPA073244) |