Anti HSPA12A pAb (ATL-HPA073244)

Catalog No:
ATL-HPA073244-25
$447.00

Description

Product Description

Protein Description: heat shock 70kDa protein 12A
Gene Name: HSPA12A
Alternative Gene Name: FLJ13874, KIAA0417
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025092: 85%, ENSRNOG00000018019: 87%
Entrez Gene ID: 259217
Uniprot ID: O43301
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MADKEAGGSDGPRETAPTSAYSSPARSLGDTGITPLSPSHIVNDTDSNVSEQQSFLVVVAV
Gene Sequence MADKEAGGSDGPRETAPTSAYSSPARSLGDTGITPLSPSHIVNDTDSNVSEQQSFLVVVAV
Gene ID - Mouse ENSMUSG00000025092
Gene ID - Rat ENSRNOG00000018019
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti HSPA12A pAb (ATL-HPA073244)
Datasheet Anti HSPA12A pAb (ATL-HPA073244) Datasheet (External Link)
Vendor Page Anti HSPA12A pAb (ATL-HPA073244) at Atlas Antibodies

Documents & Links for Anti HSPA12A pAb (ATL-HPA073244)
Datasheet Anti HSPA12A pAb (ATL-HPA073244) Datasheet (External Link)
Vendor Page Anti HSPA12A pAb (ATL-HPA073244)

Product Description

Protein Description: heat shock 70kDa protein 12A
Gene Name: HSPA12A
Alternative Gene Name: FLJ13874, KIAA0417
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025092: 85%, ENSRNOG00000018019: 87%
Entrez Gene ID: 259217
Uniprot ID: O43301
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MADKEAGGSDGPRETAPTSAYSSPARSLGDTGITPLSPSHIVNDTDSNVSEQQSFLVVVAV
Gene Sequence MADKEAGGSDGPRETAPTSAYSSPARSLGDTGITPLSPSHIVNDTDSNVSEQQSFLVVVAV
Gene ID - Mouse ENSMUSG00000025092
Gene ID - Rat ENSRNOG00000018019
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti HSPA12A pAb (ATL-HPA073244)
Datasheet Anti HSPA12A pAb (ATL-HPA073244) Datasheet (External Link)
Vendor Page Anti HSPA12A pAb (ATL-HPA073244) at Atlas Antibodies

Documents & Links for Anti HSPA12A pAb (ATL-HPA073244)
Datasheet Anti HSPA12A pAb (ATL-HPA073244) Datasheet (External Link)
Vendor Page Anti HSPA12A pAb (ATL-HPA073244)