Description
Product Description
Protein Description: heat shock transcription factor family, X-linked 2
Gene Name: HSFX2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020434: 28%, ENSRNOG00000038569: 28%
Entrez Gene ID: 100130086
Uniprot ID: Q9UBD0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: HSFX2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020434: 28%, ENSRNOG00000038569: 28%
Entrez Gene ID: 100130086
Uniprot ID: Q9UBD0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SMARCEERNSRGQDHGLERVPFPPQLQSETYLHPADPSPAWDDPGSTGSPNLRLLTEEIAFQPLAEEASFRRPHPDGDVPPQGEDNLLSLPFPQKLWRLVSSN |
Gene Sequence | SMARCEERNSRGQDHGLERVPFPPQLQSETYLHPADPSPAWDDPGSTGSPNLRLLTEEIAFQPLAEEASFRRPHPDGDVPPQGEDNLLSLPFPQKLWRLVSSN |
Gene ID - Mouse | ENSMUSG00000020434 |
Gene ID - Rat | ENSRNOG00000038569 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti HSFX2 pAb (ATL-HPA063040) | |
Datasheet | Anti HSFX2 pAb (ATL-HPA063040) Datasheet (External Link) |
Vendor Page | Anti HSFX2 pAb (ATL-HPA063040) at Atlas Antibodies |
Documents & Links for Anti HSFX2 pAb (ATL-HPA063040) | |
Datasheet | Anti HSFX2 pAb (ATL-HPA063040) Datasheet (External Link) |
Vendor Page | Anti HSFX2 pAb (ATL-HPA063040) |