Protein Description: heat shock transcription factor family member 5
Gene Name: HSF5
Alternative Gene Name: FLJ40311
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070345: 84%, ENSRNOG00000056793: 80%
Entrez Gene ID: 124535
Uniprot ID: Q4G112
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: HSF5
Alternative Gene Name: FLJ40311
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070345: 84%, ENSRNOG00000056793: 80%
Entrez Gene ID: 124535
Uniprot ID: Q4G112
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | LNHNPSPSSVVFVQEGPPFSTHQVDANIKCQTSSRENILPSEQMGFLISEMGPASKPSEDTGLATPARYREHRSNSQQGKSPDLH |
Documents & Links for Anti HSF5 pAb (ATL-HPA063613 w/enhanced validation) | |
Datasheet | Anti HSF5 pAb (ATL-HPA063613 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti HSF5 pAb (ATL-HPA063613 w/enhanced validation) at Atlas |
Documents & Links for Anti HSF5 pAb (ATL-HPA063613 w/enhanced validation) | |
Datasheet | Anti HSF5 pAb (ATL-HPA063613 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti HSF5 pAb (ATL-HPA063613 w/enhanced validation) |