Protein Description: heat shock transcription factor 2 binding protein
Gene Name: HSF2BP
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002076: 90%, ENSRNOG00000001193: 92%
Entrez Gene ID: 11077
Uniprot ID: O75031
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: HSF2BP
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002076: 90%, ENSRNOG00000001193: 92%
Entrez Gene ID: 11077
Uniprot ID: O75031
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | DNIREKKEKLALRQQLNEAKQQLLQQAEYCTEMGAAACTLLWGVSSSEEVVKAILGGDKALKFFSITGQTM |
Documents & Links for Anti HSF2BP pAb (ATL-HPA075775 w/enhanced validation) | |
Datasheet | Anti HSF2BP pAb (ATL-HPA075775 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti HSF2BP pAb (ATL-HPA075775 w/enhanced validation) at Atlas |
Documents & Links for Anti HSF2BP pAb (ATL-HPA075775 w/enhanced validation) | |
Datasheet | Anti HSF2BP pAb (ATL-HPA075775 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti HSF2BP pAb (ATL-HPA075775 w/enhanced validation) |