Anti HSF2BP pAb (ATL-HPA075775 w/enhanced validation)

Catalog No:
ATL-HPA075775-25
$447.00

Description

Product Description

Protein Description: heat shock transcription factor 2 binding protein
Gene Name: HSF2BP
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002076: 90%, ENSRNOG00000001193: 92%
Entrez Gene ID: 11077
Uniprot ID: O75031
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DNIREKKEKLALRQQLNEAKQQLLQQAEYCTEMGAAACTLLWGVSSSEEVVKAILGGDKALKFFSITGQTM
Gene Sequence DNIREKKEKLALRQQLNEAKQQLLQQAEYCTEMGAAACTLLWGVSSSEEVVKAILGGDKALKFFSITGQTM
Gene ID - Mouse ENSMUSG00000002076
Gene ID - Rat ENSRNOG00000001193
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links


Documents & Links for Anti HSF2BP pAb (ATL-HPA075775 w/enhanced validation)
Datasheet Anti HSF2BP pAb (ATL-HPA075775 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HSF2BP pAb (ATL-HPA075775 w/enhanced validation)

Product Description

Protein Description: heat shock transcription factor 2 binding protein
Gene Name: HSF2BP
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002076: 90%, ENSRNOG00000001193: 92%
Entrez Gene ID: 11077
Uniprot ID: O75031
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DNIREKKEKLALRQQLNEAKQQLLQQAEYCTEMGAAACTLLWGVSSSEEVVKAILGGDKALKFFSITGQTM
Gene Sequence DNIREKKEKLALRQQLNEAKQQLLQQAEYCTEMGAAACTLLWGVSSSEEVVKAILGGDKALKFFSITGQTM
Gene ID - Mouse ENSMUSG00000002076
Gene ID - Rat ENSRNOG00000001193
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links


Documents & Links for Anti HSF2BP pAb (ATL-HPA075775 w/enhanced validation)
Datasheet Anti HSF2BP pAb (ATL-HPA075775 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HSF2BP pAb (ATL-HPA075775 w/enhanced validation)