Anti HSD3B7 pAb (ATL-HPA060847)

Atlas Antibodies

Catalog No: ATL-HPA060847-25

• 

Product Description

Protein Description: hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 7
Gene Name: HSD3B7
Alternative Gene Name: C(27)-3BETA-HSD, SDR11E3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042289: 84%, ENSRNOG00000019080: 84%
Entrez Gene ID: 80270
Uniprot ID: Q9H2F3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LVLYAPLLNPYTLAVANTTFTVSTDKAQRHFGYEPLFSWEDSRTRTILWVQAATGSAQ
• Gene Sequence: LVLYAPLLNPYTLAVANTTFTVSTDKAQRHFGYEPLFSWEDSRTRTILWVQAATGSAQ
• Gene ID - Mouse: ENSMUSG00000042289
• Gene ID - Rat: ENSRNOG00000019080
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.