Anti HSD17B3 pAb (ATL-HPA056833 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA056833-25

• 

Product Description

Protein Description: hydroxysteroid (17-beta) dehydrogenase 3
Gene Name: HSD17B3
Alternative Gene Name: SDR12C2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033122: 76%, ENSRNOG00000019096: 80%
Entrez Gene ID: 3293
Uniprot ID: P37058
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NVGILPNLLPSHFLNAPDEIQSLIHCNITSVVKMTQLILKHMESRQKGLIL
• Gene Sequence: NVGILPNLLPSHFLNAPDEIQSLIHCNITSVVKMTQLILKHMESRQKGLIL
• Gene ID - Mouse: ENSMUSG00000033122
• Gene ID - Rat: ENSRNOG00000019096
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.