Description
Product Description
Protein Description: hydroxysteroid (11-beta) dehydrogenase 2
Gene Name: HSD11B2
Alternative Gene Name: SDR9C3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031891: 66%, ENSRNOG00000017084: 76%
Entrez Gene ID: 3291
Uniprot ID: P80365
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: HSD11B2
Alternative Gene Name: SDR9C3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031891: 66%, ENSRNOG00000017084: 76%
Entrez Gene ID: 3291
Uniprot ID: P80365
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SDLTPVVDAITDALLAARPRRRYYPGQGLGLMYFIHYYLPEGLRRRFLQAFFISHCLPRALQPGQPGTTPPQDAAQDPNLSPG |
Gene Sequence | SDLTPVVDAITDALLAARPRRRYYPGQGLGLMYFIHYYLPEGLRRRFLQAFFISHCLPRALQPGQPGTTPPQDAAQDPNLSPG |
Gene ID - Mouse | ENSMUSG00000031891 |
Gene ID - Rat | ENSRNOG00000017084 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti HSD11B2 pAb (ATL-HPA056385 w/enhanced validation) | |
Datasheet | Anti HSD11B2 pAb (ATL-HPA056385 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti HSD11B2 pAb (ATL-HPA056385 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti HSD11B2 pAb (ATL-HPA056385 w/enhanced validation) | |
Datasheet | Anti HSD11B2 pAb (ATL-HPA056385 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti HSD11B2 pAb (ATL-HPA056385 w/enhanced validation) |