Protein Description: heparan sulfate 6-O-sulfotransferase 3
Gene Name: HS6ST3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053465: 93%, ENSRNOG00000014516: 43%
Entrez Gene ID: 266722
Uniprot ID: Q8IZP7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: HS6ST3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053465: 93%, ENSRNOG00000014516: 43%
Entrez Gene ID: 266722
Uniprot ID: Q8IZP7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | QQRYHHTKQLEHQRDRQKRREERRLQREHRDHQWPKEDGAAEGTVTEDYNSQVVRW |
Gene Sequence | QQRYHHTKQLEHQRDRQKRREERRLQREHRDHQWPKEDGAAEGTVTEDYNSQVVRW |
Gene ID - Mouse | ENSMUSG00000053465 |
Gene ID - Rat | ENSRNOG00000014516 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti HS6ST3 pAb (ATL-HPA078257) | |
Datasheet | Anti HS6ST3 pAb (ATL-HPA078257) Datasheet (External Link) |
Vendor Page | Anti HS6ST3 pAb (ATL-HPA078257) at Atlas Antibodies |
Documents & Links for Anti HS6ST3 pAb (ATL-HPA078257) | |
Datasheet | Anti HS6ST3 pAb (ATL-HPA078257) Datasheet (External Link) |
Vendor Page | Anti HS6ST3 pAb (ATL-HPA078257) |