Anti HS6ST3 pAb (ATL-HPA078257)

Catalog No:
ATL-HPA078257-25
$401.00

On sale now! 25% off. Add item to cart to see discounted price. Valid thru Mar 2025.

Protein Description: heparan sulfate 6-O-sulfotransferase 3
Gene Name: HS6ST3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053465: 93%, ENSRNOG00000014516: 43%
Entrez Gene ID: 266722
Uniprot ID: Q8IZP7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence QQRYHHTKQLEHQRDRQKRREERRLQREHRDHQWPKEDGAAEGTVTEDYNSQVVRW

Documents & Links for Anti HS6ST3 pAb (ATL-HPA078257)
Datasheet Anti HS6ST3 pAb (ATL-HPA078257) Datasheet (External Link)
Vendor Page Anti HS6ST3 pAb (ATL-HPA078257) at Atlas

Documents & Links for Anti HS6ST3 pAb (ATL-HPA078257)
Datasheet Anti HS6ST3 pAb (ATL-HPA078257) Datasheet (External Link)
Vendor Page Anti HS6ST3 pAb (ATL-HPA078257)