Protein Description: heparan sulfate (glucosamine) 3-O-sulfotransferase 5
Gene Name: HS3ST5
Alternative Gene Name: 3-OST-5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044499: 99%, ENSRNOG00000000605: 99%
Entrez Gene ID: 222537
Uniprot ID: Q8IZT8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: HS3ST5
Alternative Gene Name: 3-OST-5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044499: 99%, ENSRNOG00000000605: 99%
Entrez Gene ID: 222537
Uniprot ID: Q8IZT8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | DYTQVLEGKERKNKTYYKFEKLAIDPNTCEVNTKYKAVRTSIYTKHLERWLKYFPIEQFHVVDGDRLITEPLP |
Documents & Links for Anti HS3ST5 pAb (ATL-HPA064677 w/enhanced validation) | |
Datasheet | Anti HS3ST5 pAb (ATL-HPA064677 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti HS3ST5 pAb (ATL-HPA064677 w/enhanced validation) at Atlas |
Documents & Links for Anti HS3ST5 pAb (ATL-HPA064677 w/enhanced validation) | |
Datasheet | Anti HS3ST5 pAb (ATL-HPA064677 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti HS3ST5 pAb (ATL-HPA064677 w/enhanced validation) |