Protein Description: heparan sulfate (glucosamine) 3-O-sulfotransferase 3B1
Gene Name: HS3ST3B1
Alternative Gene Name: 30ST3B1, 3OST3B1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070407: 73%, ENSRNOG00000003384: 72%
Entrez Gene ID: 9953
Uniprot ID: Q9Y662
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: HS3ST3B1
Alternative Gene Name: 30ST3B1, 3OST3B1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070407: 73%, ENSRNOG00000003384: 72%
Entrez Gene ID: 9953
Uniprot ID: Q9Y662
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LLLGSGSRAAHDPPALATAPDGTPPRLPFRAPPATPLASGKEMAEGAASPEEQSPEVPDSPSPISSFFSGSGSK |
| Documents & Links for Anti HS3ST3B1 pAb (ATL-HPA064126) | |
| Datasheet | Anti HS3ST3B1 pAb (ATL-HPA064126) Datasheet (External Link) |
| Vendor Page | Anti HS3ST3B1 pAb (ATL-HPA064126) at Atlas |
| Documents & Links for Anti HS3ST3B1 pAb (ATL-HPA064126) | |
| Datasheet | Anti HS3ST3B1 pAb (ATL-HPA064126) Datasheet (External Link) |
| Vendor Page | Anti HS3ST3B1 pAb (ATL-HPA064126) |