Anti HS3ST3A1 pAb (ATL-HPA071530)

Atlas Antibodies

Catalog No: ATL-HPA071530-25

• 
• 

Product Description

Protein Description: heparan sulfate (glucosamine) 3-O-sulfotransferase 3A1
Gene Name: HS3ST3A1
Alternative Gene Name: 30ST3A1, 3OST3A1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047759: 57%, ENSRNOG00000024591: 50%
Entrez Gene ID: 9955
Uniprot ID: Q9Y663
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RELAVWPAAAQRKRLLQLPQWRRRRPPAPRDDGEEAAWEEES
• Gene Sequence: RELAVWPAAAQRKRLLQLPQWRRRRPPAPRDDGEEAAWEEES
• Gene ID - Mouse: ENSMUSG00000047759
• Gene ID - Rat: ENSRNOG00000024591
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.