Anti HS3ST1 pAb (ATL-HPA002237 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA002237-100

• 
• 

Product Description

Protein Description: heparan sulfate (glucosamine) 3-O-sulfotransferase 1
Gene Name: HS3ST1
Alternative Gene Name: 3OST1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051022: 91%, ENSRNOG00000010598: 92%
Entrez Gene ID: 9957
Uniprot ID: O14792
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TQVFYNHMQKHKPYPSIEEFLVRDGRLNVDYKALNRSLYHVHMQNWLRFFPLRHIHIVDGDRLIRDPFPEIQKVERFLKLSPQINASNFYFNKTKGFYCLRDSGRDRCLHESKGRAHPQVDPKLLNKLHEYFHEPNKKFFELVGR
• Gene Sequence: TQVFYNHMQKHKPYPSIEEFLVRDGRLNVDYKALNRSLYHVHMQNWLRFFPLRHIHIVDGDRLIRDPFPEIQKVERFLKLSPQINASNFYFNKTKGFYCLRDSGRDRCLHESKGRAHPQVDPKLLNKLHEYFHEPNKKFFELVGR
• Gene ID - Mouse: ENSMUSG00000051022
• Gene ID - Rat: ENSRNOG00000010598
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.