Protein Description: heparan sulfate 2-O-sulfotransferase 1
Gene Name: HS2ST1
Alternative Gene Name: KIAA0448
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040151: 99%, ENSRNOG00000012549: 97%
Entrez Gene ID: 9653
Uniprot ID: Q7LGA3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: HS2ST1
Alternative Gene Name: KIAA0448
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040151: 99%, ENSRNOG00000012549: 97%
Entrez Gene ID: 9653
Uniprot ID: Q7LGA3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | GATELYRTGKKSHLRKTTEKKLPTKQTIAKLQQSDIWKMENEFYEFALEQFQFIRAHAVREKDGDLYILAQ |
| Documents & Links for Anti HS2ST1 pAb (ATL-HPA075001) | |
| Datasheet | Anti HS2ST1 pAb (ATL-HPA075001) Datasheet (External Link) |
| Vendor Page | Anti HS2ST1 pAb (ATL-HPA075001) at Atlas |
| Documents & Links for Anti HS2ST1 pAb (ATL-HPA075001) | |
| Datasheet | Anti HS2ST1 pAb (ATL-HPA075001) Datasheet (External Link) |
| Vendor Page | Anti HS2ST1 pAb (ATL-HPA075001) |