Anti HS2ST1 pAb (ATL-HPA075001)

Catalog No:
ATL-HPA075001-25
$447.00

Description

Product Description

Protein Description: heparan sulfate 2-O-sulfotransferase 1
Gene Name: HS2ST1
Alternative Gene Name: KIAA0448
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040151: 99%, ENSRNOG00000012549: 97%
Entrez Gene ID: 9653
Uniprot ID: Q7LGA3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GATELYRTGKKSHLRKTTEKKLPTKQTIAKLQQSDIWKMENEFYEFALEQFQFIRAHAVREKDGDLYILAQ
Gene Sequence GATELYRTGKKSHLRKTTEKKLPTKQTIAKLQQSDIWKMENEFYEFALEQFQFIRAHAVREKDGDLYILAQ
Gene ID - Mouse ENSMUSG00000040151
Gene ID - Rat ENSRNOG00000012549
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti HS2ST1 pAb (ATL-HPA075001)
Datasheet Anti HS2ST1 pAb (ATL-HPA075001) Datasheet (External Link)
Vendor Page Anti HS2ST1 pAb (ATL-HPA075001) at Atlas Antibodies

Documents & Links for Anti HS2ST1 pAb (ATL-HPA075001)
Datasheet Anti HS2ST1 pAb (ATL-HPA075001) Datasheet (External Link)
Vendor Page Anti HS2ST1 pAb (ATL-HPA075001)

Product Description

Protein Description: heparan sulfate 2-O-sulfotransferase 1
Gene Name: HS2ST1
Alternative Gene Name: KIAA0448
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040151: 99%, ENSRNOG00000012549: 97%
Entrez Gene ID: 9653
Uniprot ID: Q7LGA3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GATELYRTGKKSHLRKTTEKKLPTKQTIAKLQQSDIWKMENEFYEFALEQFQFIRAHAVREKDGDLYILAQ
Gene Sequence GATELYRTGKKSHLRKTTEKKLPTKQTIAKLQQSDIWKMENEFYEFALEQFQFIRAHAVREKDGDLYILAQ
Gene ID - Mouse ENSMUSG00000040151
Gene ID - Rat ENSRNOG00000012549
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti HS2ST1 pAb (ATL-HPA075001)
Datasheet Anti HS2ST1 pAb (ATL-HPA075001) Datasheet (External Link)
Vendor Page Anti HS2ST1 pAb (ATL-HPA075001) at Atlas Antibodies

Documents & Links for Anti HS2ST1 pAb (ATL-HPA075001)
Datasheet Anti HS2ST1 pAb (ATL-HPA075001) Datasheet (External Link)
Vendor Page Anti HS2ST1 pAb (ATL-HPA075001)