Protein Description: histidine rich carboxyl terminus 1
Gene Name: HRCT1
Alternative Gene Name: LGLL338, PRO537, UNQ338
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071001: 43%, ENSRNOG00000047935: 30%
Entrez Gene ID: 646962
Uniprot ID: Q6UXD1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: HRCT1
Alternative Gene Name: LGLL338, PRO537, UNQ338
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071001: 43%, ENSRNOG00000047935: 30%
Entrez Gene ID: 646962
Uniprot ID: Q6UXD1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | QDCDVERNRTAAGGNRVRRAQPWPFRRRGHLGIFHHHR |
| Documents & Links for Anti HRCT1 pAb (ATL-HPA067038) | |
| Datasheet | Anti HRCT1 pAb (ATL-HPA067038) Datasheet (External Link) |
| Vendor Page | Anti HRCT1 pAb (ATL-HPA067038) at Atlas |
| Documents & Links for Anti HRCT1 pAb (ATL-HPA067038) | |
| Datasheet | Anti HRCT1 pAb (ATL-HPA067038) Datasheet (External Link) |
| Vendor Page | Anti HRCT1 pAb (ATL-HPA067038) |