Anti HRAS pAb (ATL-HPA070222)

Atlas Antibodies

Catalog No: ATL-HPA070222-25

• 

Product Description

Protein Description: HRas proto-oncogene, GTPase
Gene Name: HRAS
Alternative Gene Name: HRAS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025499: 100%, ENSRNOG00000016611: 100%
Entrez Gene ID: 3265
Uniprot ID: P01112
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VREIRQHKLRKLNPPDESGPGCMSCKCVLS
• Gene Sequence: VREIRQHKLRKLNPPDESGPGCMSCKCVLS
• Gene ID - Mouse: ENSMUSG00000025499
• Gene ID - Rat: ENSRNOG00000016611
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.