Protein Description: HRas proto-oncogene, GTPase
Gene Name: HRAS
Alternative Gene Name: HRAS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025499: 100%, ENSRNOG00000016611: 100%
Entrez Gene ID: 3265
Uniprot ID: P01112
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: HRAS
Alternative Gene Name: HRAS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025499: 100%, ENSRNOG00000016611: 100%
Entrez Gene ID: 3265
Uniprot ID: P01112
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | VREIRQHKLRKLNPPDESGPGCMSCKCVLS |
| Documents & Links for Anti HRAS pAb (ATL-HPA070222) | |
| Datasheet | Anti HRAS pAb (ATL-HPA070222) Datasheet (External Link) |
| Vendor Page | Anti HRAS pAb (ATL-HPA070222) at Atlas |
| Documents & Links for Anti HRAS pAb (ATL-HPA070222) | |
| Datasheet | Anti HRAS pAb (ATL-HPA070222) Datasheet (External Link) |
| Vendor Page | Anti HRAS pAb (ATL-HPA070222) |