Protein Description: hemopexin
Gene Name: HPX
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030895: 79%, ENSRNOG00000018257: 81%
Entrez Gene ID: 3263
Uniprot ID: P02790
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: HPX
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030895: 79%, ENSRNOG00000018257: 81%
Entrez Gene ID: 3263
Uniprot ID: P02790
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | ECHRGECQAEGVLFFQGDREWFWDLATGTMKERSWPAVGNCSSALRWLGRYYCFQGNQFLRFDPVRGEVPPRYPRDVRDYFMPCP |
| Documents & Links for Anti HPX pAb (ATL-HPA068847) | |
| Datasheet | Anti HPX pAb (ATL-HPA068847) Datasheet (External Link) |
| Vendor Page | Anti HPX pAb (ATL-HPA068847) at Atlas |
| Documents & Links for Anti HPX pAb (ATL-HPA068847) | |
| Datasheet | Anti HPX pAb (ATL-HPA068847) Datasheet (External Link) |
| Vendor Page | Anti HPX pAb (ATL-HPA068847) |