Anti HPX pAb (ATL-HPA068847)

Catalog No:
ATL-HPA068847-25
$395.00

Description

Product Description

Protein Description: hemopexin
Gene Name: HPX
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030895: 79%, ENSRNOG00000018257: 81%
Entrez Gene ID: 3263
Uniprot ID: P02790
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ECHRGECQAEGVLFFQGDREWFWDLATGTMKERSWPAVGNCSSALRWLGRYYCFQGNQFLRFDPVRGEVPPRYPRDVRDYFMPCP
Gene Sequence ECHRGECQAEGVLFFQGDREWFWDLATGTMKERSWPAVGNCSSALRWLGRYYCFQGNQFLRFDPVRGEVPPRYPRDVRDYFMPCP
Gene ID - Mouse ENSMUSG00000030895
Gene ID - Rat ENSRNOG00000018257
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti HPX pAb (ATL-HPA068847)
Datasheet Anti HPX pAb (ATL-HPA068847) Datasheet (External Link)
Vendor Page Anti HPX pAb (ATL-HPA068847) at Atlas Antibodies

Documents & Links for Anti HPX pAb (ATL-HPA068847)
Datasheet Anti HPX pAb (ATL-HPA068847) Datasheet (External Link)
Vendor Page Anti HPX pAb (ATL-HPA068847)

Product Description

Protein Description: hemopexin
Gene Name: HPX
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030895: 79%, ENSRNOG00000018257: 81%
Entrez Gene ID: 3263
Uniprot ID: P02790
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ECHRGECQAEGVLFFQGDREWFWDLATGTMKERSWPAVGNCSSALRWLGRYYCFQGNQFLRFDPVRGEVPPRYPRDVRDYFMPCP
Gene Sequence ECHRGECQAEGVLFFQGDREWFWDLATGTMKERSWPAVGNCSSALRWLGRYYCFQGNQFLRFDPVRGEVPPRYPRDVRDYFMPCP
Gene ID - Mouse ENSMUSG00000030895
Gene ID - Rat ENSRNOG00000018257
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti HPX pAb (ATL-HPA068847)
Datasheet Anti HPX pAb (ATL-HPA068847) Datasheet (External Link)
Vendor Page Anti HPX pAb (ATL-HPA068847) at Atlas Antibodies

Documents & Links for Anti HPX pAb (ATL-HPA068847)
Datasheet Anti HPX pAb (ATL-HPA068847) Datasheet (External Link)
Vendor Page Anti HPX pAb (ATL-HPA068847)