Protein Description: HPS5, biogenesis of lysosomal organelles complex 2 subunit 2
Gene Name: HPS5
Alternative Gene Name: AIBP63, BLOC2S2, RU2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014418: 54%, ENSRNOG00000055531: 55%
Entrez Gene ID: 11234
Uniprot ID: Q9UPZ3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: HPS5
Alternative Gene Name: AIBP63, BLOC2S2, RU2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014418: 54%, ENSRNOG00000055531: 55%
Entrez Gene ID: 11234
Uniprot ID: Q9UPZ3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | NEESVDKTACECVRSPRESLDDLFQICSPCAIASGLRNDLAELTTLCLELNVLNSKIKSTSGHVDHTLQQYSPEIL |
| Documents & Links for Anti HPS5 pAb (ATL-HPA077851) | |
| Datasheet | Anti HPS5 pAb (ATL-HPA077851) Datasheet (External Link) |
| Vendor Page | Anti HPS5 pAb (ATL-HPA077851) at Atlas |
| Documents & Links for Anti HPS5 pAb (ATL-HPA077851) | |
| Datasheet | Anti HPS5 pAb (ATL-HPA077851) Datasheet (External Link) |
| Vendor Page | Anti HPS5 pAb (ATL-HPA077851) |