Anti HPS1 pAb (ATL-HPA061260)

Atlas Antibodies

Catalog No: ATL-HPA061260-25

• 

Product Description

Protein Description: Hermansky-Pudlak syndrome 1
Gene Name: HPS1
Alternative Gene Name: HPS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025188: 75%, ENSRNOG00000045838: 74%
Entrez Gene ID: 3257
Uniprot ID: Q92902
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LWQGINLVLLTRSPSAPLALVLSQLMDGFSMLEKKLKEGPEPGASLRSQPLVGDLRQRMDKFVKNRGAQEIQSTWLEFKAKAFSK
• Gene Sequence: LWQGINLVLLTRSPSAPLALVLSQLMDGFSMLEKKLKEGPEPGASLRSQPLVGDLRQRMDKFVKNRGAQEIQSTWLEFKAKAFSK
• Gene ID - Mouse: ENSMUSG00000025188
• Gene ID - Rat: ENSRNOG00000045838
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.