Anti HOXD3 pAb (ATL-HPA063671)

Catalog No:
ATL-HPA063671-25
$303.00

Description

Product Description

Protein Description: homeobox D3
Gene Name: HOXD3
Alternative Gene Name: HOX1D, HOX4, HOX4A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079277: 96%, ENSRNOG00000001577: 98%
Entrez Gene ID: 3232
Uniprot ID: P31249
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VYVGGNFVESMAPASGPVFNLGHLSHPSSASVDYSCAAQIPGNHHHGPCD
Gene Sequence VYVGGNFVESMAPASGPVFNLGHLSHPSSASVDYSCAAQIPGNHHHGPCD
Gene ID - Mouse ENSMUSG00000079277
Gene ID - Rat ENSRNOG00000001577
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti HOXD3 pAb (ATL-HPA063671)
Datasheet Anti HOXD3 pAb (ATL-HPA063671) Datasheet (External Link)
Vendor Page Anti HOXD3 pAb (ATL-HPA063671) at Atlas Antibodies

Documents & Links for Anti HOXD3 pAb (ATL-HPA063671)
Datasheet Anti HOXD3 pAb (ATL-HPA063671) Datasheet (External Link)
Vendor Page Anti HOXD3 pAb (ATL-HPA063671)

Product Description

Protein Description: homeobox D3
Gene Name: HOXD3
Alternative Gene Name: HOX1D, HOX4, HOX4A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079277: 96%, ENSRNOG00000001577: 98%
Entrez Gene ID: 3232
Uniprot ID: P31249
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VYVGGNFVESMAPASGPVFNLGHLSHPSSASVDYSCAAQIPGNHHHGPCD
Gene Sequence VYVGGNFVESMAPASGPVFNLGHLSHPSSASVDYSCAAQIPGNHHHGPCD
Gene ID - Mouse ENSMUSG00000079277
Gene ID - Rat ENSRNOG00000001577
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti HOXD3 pAb (ATL-HPA063671)
Datasheet Anti HOXD3 pAb (ATL-HPA063671) Datasheet (External Link)
Vendor Page Anti HOXD3 pAb (ATL-HPA063671) at Atlas Antibodies

Documents & Links for Anti HOXD3 pAb (ATL-HPA063671)
Datasheet Anti HOXD3 pAb (ATL-HPA063671) Datasheet (External Link)
Vendor Page Anti HOXD3 pAb (ATL-HPA063671)