Description
Product Description
Protein Description: homeobox D3
Gene Name: HOXD3
Alternative Gene Name: HOX1D, HOX4, HOX4A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079277: 96%, ENSRNOG00000001577: 98%
Entrez Gene ID: 3232
Uniprot ID: P31249
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: HOXD3
Alternative Gene Name: HOX1D, HOX4, HOX4A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079277: 96%, ENSRNOG00000001577: 98%
Entrez Gene ID: 3232
Uniprot ID: P31249
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VYVGGNFVESMAPASGPVFNLGHLSHPSSASVDYSCAAQIPGNHHHGPCD |
Gene Sequence | VYVGGNFVESMAPASGPVFNLGHLSHPSSASVDYSCAAQIPGNHHHGPCD |
Gene ID - Mouse | ENSMUSG00000079277 |
Gene ID - Rat | ENSRNOG00000001577 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti HOXD3 pAb (ATL-HPA063671) | |
Datasheet | Anti HOXD3 pAb (ATL-HPA063671) Datasheet (External Link) |
Vendor Page | Anti HOXD3 pAb (ATL-HPA063671) at Atlas Antibodies |
Documents & Links for Anti HOXD3 pAb (ATL-HPA063671) | |
Datasheet | Anti HOXD3 pAb (ATL-HPA063671) Datasheet (External Link) |
Vendor Page | Anti HOXD3 pAb (ATL-HPA063671) |