Anti HOXD13 pAb (ATL-HPA064064)

Catalog No:
ATL-HPA064064-25
$447.00

Description

Product Description

Protein Description: homeobox D13
Gene Name: HOXD13
Alternative Gene Name: HOX4I, SPD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001819: 99%, ENSRNOG00000001588: 99%
Entrez Gene ID: 3239
Uniprot ID: P35453
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SFYQGYTSPYQHVPGYIDMVSTFGSGEPRHEAYISMEGYQSWTLANGWNSQVYCTKDQPQGSHFWKSSFPG
Gene Sequence SFYQGYTSPYQHVPGYIDMVSTFGSGEPRHEAYISMEGYQSWTLANGWNSQVYCTKDQPQGSHFWKSSFPG
Gene ID - Mouse ENSMUSG00000001819
Gene ID - Rat ENSRNOG00000001588
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti HOXD13 pAb (ATL-HPA064064)
Datasheet Anti HOXD13 pAb (ATL-HPA064064) Datasheet (External Link)
Vendor Page Anti HOXD13 pAb (ATL-HPA064064) at Atlas Antibodies

Documents & Links for Anti HOXD13 pAb (ATL-HPA064064)
Datasheet Anti HOXD13 pAb (ATL-HPA064064) Datasheet (External Link)
Vendor Page Anti HOXD13 pAb (ATL-HPA064064)

Product Description

Protein Description: homeobox D13
Gene Name: HOXD13
Alternative Gene Name: HOX4I, SPD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001819: 99%, ENSRNOG00000001588: 99%
Entrez Gene ID: 3239
Uniprot ID: P35453
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SFYQGYTSPYQHVPGYIDMVSTFGSGEPRHEAYISMEGYQSWTLANGWNSQVYCTKDQPQGSHFWKSSFPG
Gene Sequence SFYQGYTSPYQHVPGYIDMVSTFGSGEPRHEAYISMEGYQSWTLANGWNSQVYCTKDQPQGSHFWKSSFPG
Gene ID - Mouse ENSMUSG00000001819
Gene ID - Rat ENSRNOG00000001588
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti HOXD13 pAb (ATL-HPA064064)
Datasheet Anti HOXD13 pAb (ATL-HPA064064) Datasheet (External Link)
Vendor Page Anti HOXD13 pAb (ATL-HPA064064) at Atlas Antibodies

Documents & Links for Anti HOXD13 pAb (ATL-HPA064064)
Datasheet Anti HOXD13 pAb (ATL-HPA064064) Datasheet (External Link)
Vendor Page Anti HOXD13 pAb (ATL-HPA064064)