Protein Description: homeobox D13
Gene Name: HOXD13
Alternative Gene Name: HOX4I, SPD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001819: 99%, ENSRNOG00000001588: 99%
Entrez Gene ID: 3239
Uniprot ID: P35453
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: HOXD13
Alternative Gene Name: HOX4I, SPD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001819: 99%, ENSRNOG00000001588: 99%
Entrez Gene ID: 3239
Uniprot ID: P35453
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | SFYQGYTSPYQHVPGYIDMVSTFGSGEPRHEAYISMEGYQSWTLANGWNSQVYCTKDQPQGSHFWKSSFPG |
| Documents & Links for Anti HOXD13 pAb (ATL-HPA064064) | |
| Datasheet | Anti HOXD13 pAb (ATL-HPA064064) Datasheet (External Link) |
| Vendor Page | Anti HOXD13 pAb (ATL-HPA064064) at Atlas |
| Documents & Links for Anti HOXD13 pAb (ATL-HPA064064) | |
| Datasheet | Anti HOXD13 pAb (ATL-HPA064064) Datasheet (External Link) |
| Vendor Page | Anti HOXD13 pAb (ATL-HPA064064) |